DTU Health Tech

Department of Health Technology

Research
Education
Collaboration
Services and Products
News
About

SHARE ON

We recently made large changes to the webserver infrastructure, so you might experience errors. Please report issues to health-master@dtu.dk

NetTurnP - 1.0

Amino acid predection in β-turns and β-turn types in proteins

Beta-turns are the most common type of non-repetitive structures, and constitute on average 25% of the residues in all protein chains. The formation of Beta-turns plays an important role in protein folding, protein stability and molecular recognition processes. A high correlation between the tendency for a sequence to form a Beta-turn and the proteins reactivity to antipeptide antibodies has been discovered, and furthermore it has been shown that there is an overrepresentation of Beta-turns in B-cell epitopes. In the area of protein-protein interactions, the formation of Beta-turns types I and II has been indicated to be essential for high-affinity binding to SH2-domains.
NetTurnP predicts if an amino acid is located in a Beta-turn or not. Optional, NetTurnP is also able to predict the nine Beta-turn subtypes.

Submission

Paste in sequence data (maximum 500 sequences)

or upload sequence data
Valid format examples: Fasta

All sequences must be submitted in amino acid format and have a unique sequence id!

Beta-turn type prediction

Type I
 Type I' Type II Type II' Type IV
Type VIII Type VIb Type VIa1 Type VIa2

Additional settings

Use Cut-off Tweak

Instructions: Paste in or upload the input file and make sure to select correct format by checking the radio button.

Please read the DTU Health Tech access policies for information about limitations on the daily number of submissions.

CITATIONS

For publication of results, please cite:

NetTurnP - Neural Network Prediction of Beta-turns by Use of Evolutionary Information and Predicted Protein Sequence Features.
Petersen B, Lundegaard C, Petersen TN (2010)
PLoS ONE 5(11):e15079 doi:10.1371/journal.pone.0015079


The electronic version of this article is found here: download

PORTABLE VERSION

Would you prefer to run NetTurnP at your own site?. Send inquiries by e-mail to bent@cbs.dtu.dk.

Instructions


1. Specify the input sequences

All the input sequences must be in one-letter amino acid code. The allowed alphabet (not case sensitive) is as follows:

A C D E F G H I K L M N P Q R S T V W Y

The sequences can be input in the following two ways:

  • Paste a single sequence (just the amino acids) or a number of sequences in FASTA format into the upper window of the main server page.

  • Select a FASTA file on your local disk, either by typing the file name into the lower window or by browsing the disk.

2. pipes


All pipes '|' will be replaced with an underscore '_' in the name of a fasta-entry eg:

>test|something
ELVISLEVER

is replaced by

>test_something
ELVISLEVER

3. Lowercase letters


All lowercase letters in a sequence will be changed to uppercase letters

4. Submit the job

Click on the "Submit" button. The status of your job (either 'queued' or 'running') will be displayed and constantly updated until it terminates and the server output appears in the browser window.

At any time during the wait you may enter your e-mail address and simply leave the window. Your job will continue; you will be notified by e-mail when it has terminated. The e-mail message will contain the URL under which the results are stored; they will remain on the server for 24 hours for you to collect them.


Output format



>2WNS.A.1 TRANSFERASE
ALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGIS
FDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTS
GSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKV
DAETVGRVKRFIQE

 A prediction of all Beta-turn types using the sequence 2WNS.A.1 will give the following output: 

# Column 1:	Amino acid
# Column 2:	Sequence name
# Column 3:	Amino acid number
# Column 4:	Prediction for Beta-turn
# Column 5:	Class assignment - "T" for Beta-turn
# Column 6:	Prediction for Beta-turn type A
# Column 7:	Class assignment - "A" for Beta-turn type I
# Column 8:	Prediction for Beta-turn type B
# Column 9:	Class assignment - "B" for Beta-turn type I'
# Column 10:	Prediction for Beta-turn type C
# Column 11:	Class assignment - "C" for Beta-turn type II
# Column 12:	Prediction for Beta-turn type D
# Column 13:	Class assignment - "D" for Beta-turn type II'
# Column 14:	Prediction for Beta-turn type E
# Column 15:	Class assignment - "E" for Beta-turn type IV
# Column 16:	Prediction for Beta-turn type F
# Column 17:	Class assignment - "F" for Beta-turn type VIII
# Column 18:	Prediction for Beta-turn type G
# Column 19:	Class assignment - "G" for Beta-turn type VIb
# Column 20:	Prediction for Beta-turn type H
# Column 21:	Class assignment - "H" for Beta-turn type VIa1
# Column 22:	Prediction for Beta-turn type I
# Column 23:	Class assignment - "I" for Beta-turn type VIa2
#
A  2WNS.A.1               1    0.171 .	0.158 .	0.123 .	0.099 .	0.108 .	0.263 .	0.155 .	0.101 .	0.125 .	0.243 .
L  2WNS.A.1               2    0.186 .	0.273 .	0.091 .	0.095 .	0.084 .	0.249 .	0.197 .	0.093 .	0.117 .	0.215 .
G  2WNS.A.1               3    0.251 .	0.329 .	0.078 .	0.095 .	0.066 .	0.262 .	0.193 .	0.077 .	0.104 .	0.192 .
P  2WNS.A.1               4    0.249 .	0.331 .	0.071 .	0.084 .	0.059 .	0.297 .	0.193 .	0.072 .	0.116 .	0.182 .
L  2WNS.A.1               5    0.231 .	0.283 .	0.079 .	0.090 .	0.065 .	0.266 .	0.182 .	0.071 .	0.128 .	0.181 .
V  2WNS.A.1               6    0.204 .	0.245 .	0.086 .	0.093 .	0.078 .	0.238 .	0.156 .	0.072 .	0.120 .	0.181 .
T  2WNS.A.1               7    0.170 .	0.192 .	0.084 .	0.086 .	0.078 .	0.234 .	0.114 .	0.070 .	0.129 .	0.190 .
G  2WNS.A.1               8    0.173 .	0.222 .	0.080 .	0.091 .	0.075 .	0.242 .	0.103 .	0.069 .	0.125 .	0.185 .
L  2WNS.A.1               9    0.211 .	0.288 .	0.086 .	0.141 .	0.086 .	0.260 .	0.114 .	0.079 .	0.129 .	0.190 .
Y  2WNS.A.1              10    0.236 .	0.339 .	0.098 .	0.150 .	0.081 .	0.260 .	0.149 .	0.087 .	0.148 .	0.202 .
D  2WNS.A.1              11    0.260 .	0.360 .	0.126 .	0.226 .	0.111 .	0.272 .	0.166 .	0.141 .	0.211 .	0.214 .
V  2WNS.A.1              12    0.283 .	0.355 .	0.144 .	0.221 .	0.217 .	0.299 .	0.289 .	0.173 .	0.216 .	0.222 .
Q  2WNS.A.1              13    0.499 .	0.310 .	0.144 .	0.232 .	0.179 .	0.403 .	0.748 F	0.166 .	0.208 .	0.232 .
A  2WNS.A.1              14    0.502 T	0.235 .	0.134 .	0.237 .	0.170 .	0.407 .	0.771 F	0.190 .	0.183 .	0.238 .
F  2WNS.A.1              15    0.498 .	0.240 .	0.131 .	0.210 .	0.180 .	0.401 .	0.750 F	0.154 .	0.156 .	0.263 .
K  2WNS.A.1              16    0.545 T	0.186 .	0.215 .	0.562 C	0.151 .	0.490 .	0.748 F	0.176 .	0.185 .	0.265 .
F  2WNS.A.1              17    0.529 T	0.207 .	0.338 .	0.613 C	0.663 D	0.508 E	0.430 .	0.275 .	0.343 .	0.334 .
G  2WNS.A.1              18    0.544 T	0.236 .	0.464 .	0.618 C	0.644 D	0.504 E	0.535 F	0.346 .	0.327 .	0.328 .
D  2WNS.A.1              19    0.538 T	0.210 .	0.422 .	0.610 C	0.637 D	0.511 E	0.500 .	0.271 .	0.306 .	0.289 .
F  2WNS.A.1              20    0.537 T	0.165 .	0.321 .	0.395 .	0.711 D	0.431 .	0.506 F	0.282 .	0.250 .	0.272 .
V  2WNS.A.1              21    0.277 .	0.161 .	0.190 .	0.219 .	0.202 .	0.332 .	0.518 F	0.160 .	0.144 .	0.237 .
L  2WNS.A.1              22    0.462 .	0.450 .	0.140 .	0.211 .	0.101 .	0.400 .	0.400 .	0.141 .	0.146 .	0.257 .
K  2WNS.A.1              23    0.513 T	0.474 .	0.349 .	0.377 .	0.218 .	0.443 .	0.409 .	0.156 .	0.191 .	0.289 .
S  2WNS.A.1              24    0.573 T	0.508 A	0.503 B	0.378 .	0.632 D	0.504 E	0.412 .	0.175 .	0.200 .	0.306 .
G  2WNS.A.1              25    0.624 T	0.549 A	0.489 .	0.415 .	0.688 D	0.551 E	0.476 .	0.167 .	0.191 .	0.363 .
L  2WNS.A.1              26    0.561 T	0.397 .	0.519 B	0.391 .	0.691 D	0.540 E	0.532 F	0.180 .	0.190 .	0.320 .
S  2WNS.A.1              27    0.510 T	0.369 .	0.353 .	0.266 .	0.724 D	0.534 E	0.518 F	0.274 .	0.362 .	0.368 .
S  2WNS.A.1              28    0.585 T	0.456 .	0.189 .	0.267 .	0.496 .	0.514 E	0.640 F	0.271 .	0.316 .	0.352 .
P  2WNS.A.1              29    0.515 T	0.385 .	0.160 .	0.257 .	0.262 .	0.475 .	0.618 F	0.276 .	0.308 .	0.292 .
I  2WNS.A.1              30    0.506 T	0.391 .	0.166 .	0.240 .	0.255 .	0.456 .	0.588 F	0.257 .	0.301 .	0.319 .
Y  2WNS.A.1              31    0.560 T	0.418 .	0.222 .	0.276 .	0.225 .	0.534 E	0.613 F	0.153 .	0.148 .	0.277 .
I  2WNS.A.1              32    0.396 .	0.295 .	0.343 .	0.231 .	0.218 .	0.494 .	0.445 .	0.143 .	0.168 .	0.295 .
D  2WNS.A.1              33    0.463 .	0.383 .	0.324 .	0.209 .	0.291 .	0.568 E	0.410 .	0.163 .	0.247 .	0.382 .
L  2WNS.A.1              34    0.532 T	0.456 .	0.342 .	0.318 .	0.266 .	0.596 E	0.384 .	0.255 .	0.328 .	0.495 .
R  2WNS.A.1              35    0.481 .	0.452 .	0.238 .	0.321 .	0.271 .	0.557 E	0.440 .	0.243 .	0.342 .	0.532 I
G  2WNS.A.1              36    0.508 T	0.511 A	0.152 .	0.379 .	0.224 .	0.576 E	0.460 .	0.304 .	0.329 .	0.497 .
I  2WNS.A.1              37    0.553 T	0.587 A	0.203 .	0.516 C	0.310 .	0.553 E	0.458 .	0.242 .	0.345 .	0.416 .
V  2WNS.A.1              38    0.557 T	0.559 A	0.219 .	0.431 .	0.344 .	0.577 E	0.716 F	0.208 .	0.261 .	0.299 .
S  2WNS.A.1              39    0.553 T	0.565 A	0.272 .	0.394 .	0.352 .	0.548 E	0.704 F	0.431 .	0.431 .	0.343 .
R  2WNS.A.1              40    0.537 T	0.565 A	0.261 .	0.304 .	0.386 .	0.529 E	0.681 F	0.279 .	0.443 .	0.327 .
P  2WNS.A.1              41    0.436 .	0.327 .	0.222 .	0.221 .	0.270 .	0.507 E	0.696 F	0.317 .	0.341 .	0.298 .
R  2WNS.A.1              42    0.268 .	0.282 .	0.185 .	0.197 .	0.171 .	0.303 .	0.158 .	0.208 .	0.344 .	0.287 .
L  2WNS.A.1              43    0.267 .	0.306 .	0.131 .	0.181 .	0.154 .	0.293 .	0.129 .	0.066 .	0.176 .	0.209 .
L  2WNS.A.1              44    0.229 .	0.252 .	0.127 .	0.164 .	0.093 .	0.259 .	0.119 .	0.076 .	0.121 .	0.196 .
S  2WNS.A.1              45    0.189 .	0.246 .	0.103 .	0.099 .	0.099 .	0.239 .	0.102 .	0.069 .	0.127 .	0.202 .
Q  2WNS.A.1              46    0.192 .	0.248 .	0.091 .	0.091 .	0.097 .	0.256 .	0.093 .	0.072 .	0.121 .	0.193 .
V  2WNS.A.1              47    0.204 .	0.254 .	0.095 .	0.090 .	0.138 .	0.250 .	0.099 .	0.078 .	0.115 .	0.190 .
A  2WNS.A.1              48    0.192 .	0.249 .	0.097 .	0.104 .	0.139 .	0.245 .	0.109 .	0.081 .	0.112 .	0.185 .
D  2WNS.A.1              49    0.195 .	0.244 .	0.092 .	0.098 .	0.142 .	0.261 .	0.104 .	0.077 .	0.115 .	0.183 .
I  2WNS.A.1              50    0.190 .	0.248 .	0.092 .	0.089 .	0.143 .	0.248 .	0.102 .	0.079 .	0.115 .	0.185 .
L  2WNS.A.1              51    0.204 .	0.245 .	0.098 .	0.099 .	0.121 .	0.267 .	0.116 .	0.082 .	0.130 .	0.184 .
F  2WNS.A.1              52    0.220 .	0.287 .	0.094 .	0.096 .	0.093 .	0.255 .	0.122 .	0.091 .	0.124 .	0.184 .
Q  2WNS.A.1              53    0.198 .	0.241 .	0.086 .	0.091 .	0.075 .	0.257 .	0.138 .	0.085 .	0.125 .	0.185 .
T  2WNS.A.1              54    0.201 .	0.270 .	0.085 .	0.091 .	0.073 .	0.258 .	0.124 .	0.096 .	0.135 .	0.186 .
A  2WNS.A.1              55    0.278 .	0.356 .	0.112 .	0.275 .	0.103 .	0.295 .	0.146 .	0.112 .	0.127 .	0.190 .
Q  2WNS.A.1              56    0.321 .	0.364 .	0.132 .	0.265 .	0.092 .	0.339 .	0.176 .	0.133 .	0.154 .	0.196 .
N  2WNS.A.1              57    0.362 .	0.432 .	0.221 .	0.308 .	0.146 .	0.377 .	0.231 .	0.172 .	0.272 .	0.231 .
A  2WNS.A.1              58    0.408 .	0.445 .	0.367 .	0.349 .	0.276 .	0.399 .	0.360 .	0.315 .	0.312 .	0.298 .
G  2WNS.A.1              59    0.414 .	0.525 A	0.332 .	0.230 .	0.289 .	0.385 .	0.410 .	0.375 .	0.363 .	0.348 .
I  2WNS.A.1              60    0.415 .	0.487 .	0.348 .	0.268 .	0.311 .	0.399 .	0.551 F	0.490 .	0.390 .	0.380 .
S  2WNS.A.1              61    0.378 .	0.456 .	0.263 .	0.248 .	0.288 .	0.359 .	0.551 F	0.475 .	0.352 .	0.318 .
F  2WNS.A.1              62    0.501 T	0.429 .	0.152 .	0.213 .	0.214 .	0.420 .	0.735 F	0.381 .	0.276 .	0.257 .
D  2WNS.A.1              63    0.449 .	0.212 .	0.120 .	0.189 .	0.117 .	0.407 .	0.740 F	0.249 .	0.201 .	0.230 .
T  2WNS.A.1              64    0.399 .	0.150 .	0.114 .	0.142 .	0.106 .	0.379 .	0.688 F	0.144 .	0.149 .	0.217 .
V  2WNS.A.1              65    0.423 .	0.082 .	0.122 .	0.109 .	0.092 .	0.405 .	0.684 F	0.118 .	0.130 .	0.230 .
C  2WNS.A.1              66    0.153 .	0.064 .	0.114 .	0.092 .	0.104 .	0.250 .	0.202 .	0.234 .	0.182 .	0.275 .
G  2WNS.A.1              67    0.200 .	0.282 .	0.120 .	0.116 .	0.154 .	0.326 .	0.169 .	0.501 .	0.338 .	0.369 .
V  2WNS.A.1              68    0.345 .	0.457 .	0.128 .	0.218 .	0.209 .	0.388 .	0.280 .	0.489 .	0.357 .	0.392 .
P  2WNS.A.1              69    0.538 T	0.552 A	0.140 .	0.449 .	0.242 .	0.457 .	0.318 .	0.499 .	0.416 .	0.404 .
Y  2WNS.A.1              70    0.567 T	0.598 A	0.216 .	0.511 C	0.489 .	0.493 .	0.330 .	0.380 .	0.400 .	0.376 .
T  2WNS.A.1              71    0.579 T	0.560 A	0.191 .	0.501 C	0.536 D	0.491 .	0.313 .	0.132 .	0.253 .	0.306 .
A  2WNS.A.1              72    0.532 T	0.493 .	0.179 .	0.415 .	0.511 D	0.487 .	0.215 .	0.202 .	0.313 .	0.335 .
L  2WNS.A.1              73    0.386 .	0.366 .	0.152 .	0.210 .	0.520 D	0.404 .	0.205 .	0.186 .	0.363 .	0.318 .
P  2WNS.A.1              74    0.290 .	0.232 .	0.090 .	0.117 .	0.288 .	0.338 .	0.196 .	0.160 .	0.276 .	0.304 .
L  2WNS.A.1              75    0.245 .	0.235 .	0.075 .	0.121 .	0.115 .	0.282 .	0.147 .	0.188 .	0.280 .	0.300 .
A  2WNS.A.1              76    0.236 .	0.220 .	0.082 .	0.133 .	0.096 .	0.258 .	0.134 .	0.109 .	0.212 .	0.235 .
T  2WNS.A.1              77    0.206 .	0.199 .	0.083 .	0.126 .	0.089 .	0.236 .	0.112 .	0.094 .	0.128 .	0.206 .
V  2WNS.A.1              78    0.157 .	0.189 .	0.081 .	0.091 .	0.078 .	0.216 .	0.092 .	0.088 .	0.123 .	0.200 .
I  2WNS.A.1              79    0.163 .	0.188 .	0.086 .	0.083 .	0.076 .	0.224 .	0.082 .	0.078 .	0.117 .	0.190 .
C  2WNS.A.1              80    0.188 .	0.207 .	0.086 .	0.110 .	0.077 .	0.250 .	0.098 .	0.093 .	0.109 .	0.191 .
S  2WNS.A.1              81    0.243 .	0.320 .	0.093 .	0.122 .	0.081 .	0.260 .	0.088 .	0.095 .	0.117 .	0.199 .
T  2WNS.A.1              82    0.260 .	0.342 .	0.156 .	0.182 .	0.167 .	0.268 .	0.085 .	0.104 .	0.166 .	0.220 .
N  2WNS.A.1              83    0.252 .	0.361 .	0.193 .	0.199 .	0.286 .	0.262 .	0.132 .	0.136 .	0.173 .	0.227 .
Q  2WNS.A.1              84    0.219 .	0.374 .	0.198 .	0.197 .	0.298 .	0.194 .	0.112 .	0.323 .	0.385 .	0.275 .
I  2WNS.A.1              85    0.202 .	0.218 .	0.225 .	0.247 .	0.307 .	0.278 .	0.308 .	0.388 .	0.328 .	0.256 .
P  2WNS.A.1              86    0.180 .	0.139 .	0.146 .	0.196 .	0.211 .	0.281 .	0.319 .	0.372 .	0.252 .	0.233 .
M  2WNS.A.1              87    0.207 .	0.134 .	0.123 .	0.177 .	0.155 .	0.282 .	0.347 .	0.515 G	0.271 .	0.228 .
L  2WNS.A.1              88    0.224 .	0.122 .	0.108 .	0.152 .	0.094 .	0.303 .	0.389 .	0.193 .	0.118 .	0.202 .
I  2WNS.A.1              89    0.194 .	0.103 .	0.100 .	0.098 .	0.090 .	0.273 .	0.350 .	0.185 .	0.119 .	0.208 .
R  2WNS.A.1              90    0.233 .	0.096 .	0.110 .	0.124 .	0.089 .	0.308 .	0.320 .	0.319 .	0.134 .	0.266 .
R  2WNS.A.1              91    0.316 .	0.219 .	0.149 .	0.138 .	0.105 .	0.422 .	0.445 .	0.399 .	0.223 .	0.347 .
K  2WNS.A.1              92    0.520 T	0.388 .	0.313 .	0.384 .	0.174 .	0.553 E	0.479 .	0.442 .	0.358 .	0.416 .
E  2WNS.A.1              93    0.567 T	0.447 .	0.455 .	0.509 C	0.410 .	0.577 E	0.484 .	0.487 .	0.456 .	0.488 .
T  2WNS.A.1              94    0.634 T	0.507 A	0.494 .	0.567 C	0.486 .	0.605 E	0.556 F	0.395 .	0.462 .	0.450 .
K  2WNS.A.1              95    0.655 T	0.536 A	0.522 B	0.604 C	0.519 D	0.596 E	0.544 F	0.390 .	0.403 .	0.382 .
D  2WNS.A.1              96    0.599 T	0.518 A	0.535 B	0.624 C	0.485 .	0.535 E	0.524 F	0.300 .	0.308 .	0.314 .
Y  2WNS.A.1              97    0.556 T	0.512 A	0.389 .	0.575 C	0.537 D	0.526 E	0.522 F	0.246 .	0.215 .	0.267 .
G  2WNS.A.1              98    0.572 T	0.504 A	0.394 .	0.596 C	0.501 D	0.552 E	0.449 .	0.223 .	0.190 .	0.254 .
T  2WNS.A.1              99    0.547 T	0.468 .	0.435 .	0.598 C	0.514 D	0.535 E	0.444 .	0.144 .	0.171 .	0.229 .
K  2WNS.A.1             100    0.493 .	0.406 .	0.310 .	0.426 .	0.543 D	0.544 E	0.461 .	0.142 .	0.142 .	0.216 .
R  2WNS.A.1             101    0.454 .	0.317 .	0.258 .	0.385 .	0.322 .	0.532 E	0.463 .	0.151 .	0.133 .	0.210 .
L  2WNS.A.1             102    0.390 .	0.247 .	0.236 .	0.234 .	0.216 .	0.464 .	0.470 .	0.133 .	0.129 .	0.214 .
V  2WNS.A.1             103    0.421 .	0.196 .	0.318 .	0.532 C	0.241 .	0.500 E	0.445 .	0.157 .	0.127 .	0.230 .
E  2WNS.A.1             104    0.425 .	0.216 .	0.292 .	0.504 C	0.473 .	0.524 E	0.409 .	0.235 .	0.154 .	0.261 .
G  2WNS.A.1             105    0.437 .	0.284 .	0.304 .	0.495 .	0.399 .	0.518 E	0.517 F	0.342 .	0.207 .	0.392 .
T  2WNS.A.1             106    0.450 .	0.359 .	0.287 .	0.491 .	0.368 .	0.545 E	0.571 F	0.439 .	0.260 .	0.443 .
I  2WNS.A.1             107    0.377 .	0.396 .	0.199 .	0.285 .	0.395 .	0.546 E	0.582 F	0.507 G	0.464 .	0.586 I
N  2WNS.A.1             108    0.815 T	0.518 A	0.261 .	0.827 C	0.293 .	0.568 E	0.579 F	0.439 .	0.547 H	0.549 I
P  2WNS.A.1             109    0.810 T	0.485 .	0.260 .	0.850 C	0.422 .	0.555 E	0.477 .	0.381 .	0.490 .	0.441 .
G  2WNS.A.1             110    0.836 T	0.486 .	0.258 .	0.851 C	0.472 .	0.508 E	0.420 .	0.291 .	0.477 .	0.376 .
E  2WNS.A.1             111    0.835 T	0.466 .	0.266 .	0.846 C	0.455 .	0.459 .	0.436 .	0.194 .	0.277 .	0.250 .
T  2WNS.A.1             112    0.274 .	0.244 .	0.162 .	0.375 .	0.374 .	0.360 .	0.422 .	0.169 .	0.153 .	0.224 .
C  2WNS.A.1             113    0.263 .	0.149 .	0.107 .	0.156 .	0.185 .	0.326 .	0.469 .	0.156 .	0.134 .	0.209 .
L  2WNS.A.1             114    0.160 .	0.087 .	0.093 .	0.092 .	0.086 .	0.202 .	0.396 .	0.139 .	0.123 .	0.204 .
I  2WNS.A.1             115    0.161 .	0.068 .	0.095 .	0.091 .	0.091 .	0.223 .	0.315 .	0.136 .	0.129 .	0.218 .
I  2WNS.A.1             116    0.261 .	0.096 .	0.112 .	0.114 .	0.109 .	0.371 .	0.372 .	0.158 .	0.148 .	0.243 .
E  2WNS.A.1             117    0.325 .	0.161 .	0.111 .	0.135 .	0.128 .	0.447 .	0.368 .	0.151 .	0.175 .	0.266 .
D  2WNS.A.1             118    0.378 .	0.290 .	0.105 .	0.162 .	0.140 .	0.493 .	0.442 .	0.161 .	0.182 .	0.291 .
V  2WNS.A.1             119    0.440 .	0.390 .	0.105 .	0.176 .	0.124 .	0.515 E	0.459 .	0.154 .	0.190 .	0.289 .
V  2WNS.A.1             120    0.550 T	0.451 .	0.103 .	0.197 .	0.124 .	0.566 E	0.453 .	0.146 .	0.193 .	0.276 .
T  2WNS.A.1             121    0.529 T	0.429 .	0.175 .	0.321 .	0.183 .	0.554 E	0.429 .	0.140 .	0.189 .	0.266 .
S  2WNS.A.1             122    0.524 T	0.427 .	0.326 .	0.409 .	0.408 .	0.534 E	0.312 .	0.122 .	0.169 .	0.248 .
G  2WNS.A.1             123    0.511 T	0.390 .	0.296 .	0.376 .	0.448 .	0.520 E	0.255 .	0.125 .	0.160 .	0.239 .
S  2WNS.A.1             124    0.323 .	0.264 .	0.298 .	0.346 .	0.441 .	0.393 .	0.156 .	0.111 .	0.152 .	0.225 .
S  2WNS.A.1             125    0.283 .	0.285 .	0.240 .	0.174 .	0.395 .	0.347 .	0.131 .	0.094 .	0.134 .	0.210 .
V  2WNS.A.1             126    0.227 .	0.240 .	0.116 .	0.096 .	0.172 .	0.305 .	0.106 .	0.098 .	0.129 .	0.197 .
L  2WNS.A.1             127    0.188 .	0.215 .	0.093 .	0.099 .	0.092 .	0.261 .	0.085 .	0.089 .	0.124 .	0.193 .
E  2WNS.A.1             128    0.179 .	0.202 .	0.101 .	0.101 .	0.088 .	0.246 .	0.098 .	0.082 .	0.115 .	0.194 .
T  2WNS.A.1             129    0.164 .	0.202 .	0.092 .	0.108 .	0.100 .	0.244 .	0.097 .	0.097 .	0.117 .	0.187 .
V  2WNS.A.1             130    0.160 .	0.196 .	0.087 .	0.091 .	0.094 .	0.234 .	0.103 .	0.108 .	0.115 .	0.182 .
E  2WNS.A.1             131    0.152 .	0.161 .	0.081 .	0.081 .	0.081 .	0.236 .	0.119 .	0.097 .	0.117 .	0.186 .
V  2WNS.A.1             132    0.141 .	0.170 .	0.078 .	0.087 .	0.078 .	0.217 .	0.101 .	0.107 .	0.118 .	0.185 .
L  2WNS.A.1             133    0.167 .	0.190 .	0.081 .	0.135 .	0.096 .	0.242 .	0.111 .	0.123 .	0.121 .	0.190 .
Q  2WNS.A.1             134    0.218 .	0.300 .	0.088 .	0.155 .	0.077 .	0.245 .	0.111 .	0.129 .	0.139 .	0.205 .
K  2WNS.A.1             135    0.227 .	0.317 .	0.136 .	0.196 .	0.124 .	0.241 .	0.101 .	0.158 .	0.194 .	0.220 .
E  2WNS.A.1             136    0.244 .	0.331 .	0.331 .	0.221 .	0.292 .	0.227 .	0.128 .	0.224 .	0.198 .	0.229 .
G  2WNS.A.1             137    0.233 .	0.316 .	0.296 .	0.199 .	0.296 .	0.221 .	0.166 .	0.197 .	0.208 .	0.231 .
L  2WNS.A.1             138    0.193 .	0.180 .	0.307 .	0.187 .	0.269 .	0.265 .	0.265 .	0.299 .	0.185 .	0.224 .
K  2WNS.A.1             139    0.169 .	0.141 .	0.293 .	0.152 .	0.213 .	0.224 .	0.264 .	0.222 .	0.147 .	0.208 .
V  2WNS.A.1             140    0.207 .	0.142 .	0.151 .	0.162 .	0.128 .	0.267 .	0.377 .	0.218 .	0.140 .	0.202 .
T  2WNS.A.1             141    0.191 .	0.089 .	0.128 .	0.144 .	0.107 .	0.233 .	0.344 .	0.178 .	0.128 .	0.204 .
D  2WNS.A.1             142    0.143 .	0.071 .	0.169 .	0.157 .	0.129 .	0.176 .	0.224 .	0.133 .	0.128 .	0.211 .
A  2WNS.A.1             143    0.147 .	0.069 .	0.181 .	0.157 .	0.142 .	0.183 .	0.207 .	0.138 .	0.122 .	0.216 .
I  2WNS.A.1             144    0.108 .	0.064 .	0.148 .	0.106 .	0.144 .	0.142 .	0.132 .	0.135 .	0.120 .	0.215 .
V  2WNS.A.1             145    0.103 .	0.064 .	0.138 .	0.098 .	0.125 .	0.190 .	0.130 .	0.135 .	0.116 .	0.223 .
L  2WNS.A.1             146    0.112 .	0.080 .	0.117 .	0.090 .	0.108 .	0.225 .	0.160 .	0.145 .	0.117 .	0.234 .
L  2WNS.A.1             147    0.159 .	0.108 .	0.110 .	0.111 .	0.115 .	0.278 .	0.216 .	0.183 .	0.125 .	0.276 .
D  2WNS.A.1             148    0.533 T	0.484 .	0.156 .	0.209 .	0.169 .	0.511 E	0.378 .	0.276 .	0.201 .	0.328 .
R  2WNS.A.1             149    0.566 T	0.556 A	0.218 .	0.251 .	0.201 .	0.533 E	0.402 .	0.343 .	0.385 .	0.378 .
E  2WNS.A.1             150    0.699 T	0.610 A	0.432 .	0.542 C	0.302 .	0.604 E	0.440 .	0.396 .	0.608 H	0.474 .
Q  2WNS.A.1             151    0.708 T	0.629 A	0.656 B	0.653 C	0.429 .	0.615 E	0.447 .	0.384 .	0.572 H	0.395 .
G  2WNS.A.1             152    0.605 T	0.534 A	0.578 B	0.606 C	0.474 .	0.568 E	0.400 .	0.251 .	0.500 H	0.348 .
G  2WNS.A.1             153    0.556 T	0.457 .	0.557 B	0.641 C	0.460 .	0.550 E	0.365 .	0.196 .	0.384 .	0.295 .
K  2WNS.A.1             154    0.353 .	0.323 .	0.430 .	0.418 .	0.419 .	0.433 .	0.278 .	0.132 .	0.170 .	0.223 .
D  2WNS.A.1             155    0.280 .	0.286 .	0.148 .	0.200 .	0.286 .	0.373 .	0.310 .	0.109 .	0.152 .	0.219 .
K  2WNS.A.1             156    0.257 .	0.289 .	0.107 .	0.158 .	0.128 .	0.353 .	0.293 .	0.110 .	0.155 .	0.206 .
L  2WNS.A.1             157    0.312 .	0.424 .	0.107 .	0.197 .	0.141 .	0.354 .	0.279 .	0.147 .	0.177 .	0.211 .
Q  2WNS.A.1             158    0.384 .	0.483 .	0.119 .	0.228 .	0.135 .	0.378 .	0.332 .	0.154 .	0.177 .	0.220 .
A  2WNS.A.1             159    0.398 .	0.536 A	0.217 .	0.320 .	0.273 .	0.378 .	0.264 .	0.189 .	0.269 .	0.242 .
H  2WNS.A.1             160    0.425 .	0.554 A	0.244 .	0.334 .	0.350 .	0.389 .	0.367 .	0.234 .	0.251 .	0.251 .
G  2WNS.A.1             161    0.397 .	0.513 A	0.234 .	0.279 .	0.336 .	0.332 .	0.325 .	0.528 G	0.348 .	0.277 .
I  2WNS.A.1             162    0.290 .	0.367 .	0.243 .	0.276 .	0.319 .	0.321 .	0.361 .	0.557 G	0.314 .	0.258 .
R  2WNS.A.1             163    0.211 .	0.187 .	0.138 .	0.170 .	0.209 .	0.301 .	0.336 .	0.536 G	0.220 .	0.231 .
L  2WNS.A.1             164    0.202 .	0.160 .	0.112 .	0.137 .	0.135 .	0.273 .	0.321 .	0.605 G	0.225 .	0.226 .
H  2WNS.A.1             165    0.186 .	0.122 .	0.105 .	0.134 .	0.103 .	0.265 .	0.344 .	0.198 .	0.135 .	0.208 .
S  2WNS.A.1             166    0.220 .	0.110 .	0.100 .	0.108 .	0.100 .	0.244 .	0.540 F	0.191 .	0.130 .	0.213 .
V  2WNS.A.1             167    0.203 .	0.104 .	0.099 .	0.109 .	0.099 .	0.232 .	0.557 F	0.168 .	0.135 .	0.227 .
C  2WNS.A.1             168    0.182 .	0.103 .	0.102 .	0.110 .	0.117 .	0.234 .	0.564 F	0.149 .	0.122 .	0.230 .
T  2WNS.A.1             169    0.239 .	0.178 .	0.101 .	0.112 .	0.174 .	0.303 .	0.578 F	0.158 .	0.145 .	0.255 .
L  2WNS.A.1             170    0.291 .	0.262 .	0.111 .	0.177 .	0.215 .	0.349 .	0.396 .	0.181 .	0.177 .	0.276 .
S  2WNS.A.1             171    0.258 .	0.281 .	0.108 .	0.187 .	0.189 .	0.356 .	0.350 .	0.158 .	0.180 .	0.267 .
K  2WNS.A.1             172    0.289 .	0.311 .	0.108 .	0.192 .	0.180 .	0.368 .	0.370 .	0.164 .	0.202 .	0.265 .
M  2WNS.A.1             173    0.299 .	0.309 .	0.112 .	0.207 .	0.142 .	0.360 .	0.389 .	0.133 .	0.201 .	0.237 .
L  2WNS.A.1             174    0.208 .	0.231 .	0.109 .	0.153 .	0.083 .	0.301 .	0.176 .	0.128 .	0.171 .	0.207 .
E  2WNS.A.1             175    0.187 .	0.211 .	0.103 .	0.120 .	0.072 .	0.264 .	0.123 .	0.129 .	0.163 .	0.205 .
I  2WNS.A.1             176    0.164 .	0.192 .	0.098 .	0.122 .	0.079 .	0.243 .	0.129 .	0.121 .	0.145 .	0.194 .
L  2WNS.A.1             177    0.205 .	0.267 .	0.116 .	0.180 .	0.083 .	0.291 .	0.145 .	0.144 .	0.128 .	0.186 .
E  2WNS.A.1             178    0.269 .	0.385 .	0.152 .	0.165 .	0.080 .	0.331 .	0.191 .	0.138 .	0.139 .	0.193 .
Q  2WNS.A.1             179    0.294 .	0.389 .	0.223 .	0.180 .	0.141 .	0.367 .	0.206 .	0.269 .	0.223 .	0.210 .
Q  2WNS.A.1             180    0.425 .	0.521 A	0.283 .	0.193 .	0.301 .	0.416 .	0.327 .	0.325 .	0.246 .	0.224 .
K  2WNS.A.1             181    0.611 T	0.510 A	0.282 .	0.205 .	0.261 .	0.443 .	0.738 F	0.339 .	0.223 .	0.244 .
K  2WNS.A.1             182    0.619 T	0.423 .	0.222 .	0.223 .	0.249 .	0.412 .	0.761 F	0.383 .	0.240 .	0.262 .
V  2WNS.A.1             183    0.595 T	0.394 .	0.173 .	0.203 .	0.257 .	0.373 .	0.745 F	0.282 .	0.208 .	0.249 .
D  2WNS.A.1             184    0.530 T	0.355 .	0.156 .	0.282 .	0.197 .	0.396 .	0.748 F	0.193 .	0.200 .	0.235 .
A  2WNS.A.1             185    0.328 .	0.339 .	0.162 .	0.276 .	0.208 .	0.360 .	0.315 .	0.166 .	0.211 .	0.223 .
E  2WNS.A.1             186    0.303 .	0.338 .	0.177 .	0.240 .	0.211 .	0.348 .	0.225 .	0.138 .	0.183 .	0.215 .
T  2WNS.A.1             187    0.341 .	0.344 .	0.161 .	0.242 .	0.161 .	0.349 .	0.227 .	0.162 .	0.196 .	0.206 .
V  2WNS.A.1             188    0.251 .	0.280 .	0.116 .	0.158 .	0.117 .	0.299 .	0.224 .	0.161 .	0.148 .	0.196 .
G  2WNS.A.1             189    0.176 .	0.179 .	0.085 .	0.097 .	0.089 .	0.274 .	0.156 .	0.134 .	0.141 .	0.193 .
R  2WNS.A.1             190    0.166 .	0.185 .	0.078 .	0.094 .	0.080 .	0.262 .	0.124 .	0.132 .	0.145 .	0.188 .
V  2WNS.A.1             191    0.172 .	0.186 .	0.084 .	0.117 .	0.086 .	0.267 .	0.113 .	0.111 .	0.120 .	0.181 .
K  2WNS.A.1             192    0.182 .	0.184 .	0.088 .	0.118 .	0.083 .	0.285 .	0.108 .	0.126 .	0.113 .	0.175 .
R  2WNS.A.1             193    0.222 .	0.251 .	0.080 .	0.113 .	0.079 .	0.298 .	0.106 .	0.138 .	0.111 .	0.173 .
F  2WNS.A.1             194    0.295 .	0.325 .	0.089 .	0.137 .	0.074 .	0.360 .	0.108 .	0.159 .	0.109 .	0.169 .
I  2WNS.A.1             195    0.310 .	0.329 .	0.120 .	0.155 .	0.071 .	0.363 .	0.136 .	0.178 .	0.113 .	0.177 .
Q  2WNS.A.1             196    0.300 .	0.335 .	0.127 .	0.150 .	0.069 .	0.337 .	0.116 .	0.118 .	0.112 .	0.187 .
E  2WNS.A.1             197    0.288 .	0.307 .	0.165 .	0.171 .	0.089 .	0.350 .	0.084 .	0.126 .	0.150 .	0.210 .

References

NetTurnp - Neural Network Prediction of Beta-turns by Use of Evolutionary Information and Predicted Protein Sequence Features.
Petersen B, Lundegaard C, Petersen TN1 (2010)
PLoS ONE 5(11):e15079 doi:10.1371/journal.pone.0015079

1to whom correspondence should be addressed, e-mail: tnp@cbs.dtu.dk

Center for Biological Sequence Analysis, CBS, Department of Systems Biology.
The Technical University of Denmark, DK-2800 Lyngby, Denmark.


ABSTRACT

Beta-turns are the most common type of non-repetitive structures, and constitute on average 25% of the amino acids in proteins. The formation of beta-turns plays an important role in protein folding, protein stability and molecular recognition processes. In this work we present the neural network method NetTurnP, for prediction of two-class beta-turns and prediction of the individual beta-turn types by use of evolutionary information and predicted protein sequence features. It has been evaluated against a commonly used dataset BT426, and achieves a Matthews correlation coefficient of 0.50, which is the highest reported performance on a two-class prediction of beta-turn and not-beta-turn. Furthermore NetTurnP shows improved performance on some of the specific beta-turn types. In the present work, neural network methods have been trained to predict beta-turn or not and individual beta-turn types from the primary amino acid sequence. The individual beta-turn types I', II, II', VIII, VIa1, VIa2, VIba and IV have been predicted based on classifications by PROMOTIF, and the two-class prediction of beta-turn or not is a superset comprised of all beta-turn types. The performance is evaluated using a golden set of non-homologous sequences known as BT426. Our two-class prediction method achieves a performance of: MCC = 0.50, Qtotal = 82.1%, sensitivity = 75.6%, PPV = 68.8% and AUC = 0.864. We have compared our performance to eleven other prediction methods that obtain Matthews correlation coefficients in the range of 0.17 -0.47. For the type specific beta-turn predictions, only type I and II can be predicted with reasonable Matthews correlation coefficients, where we obtain performance values of 0.36 and 0.31, respectively.

The electronic version of this article is found here: download

Software Downloads


GETTING HELP

If you need help regarding technical issues (e.g. errors or missing results) contact Technical Support. Please include the name of the service and version (e.g. NetPhos-4.0). If the error occurs after the job has started running, please include the JOB ID (the long code that you see while the job is running).

If you have scientific questions (e.g. how the method works or how to interpret results), contact Correspondence.

Correspondence: Technical Support: