Output format



DESCRIPTION

For each input sequence the length and the name of the sequence are stated followed by a table with the prediction results. There is a table row for each serine or threonine residue in the sequence; the columns are:

After the table, the whole sequence is printed alongside a summary of the predicted glycation sites and their positions.

Finally, if the 'Generate graphics' button has been checked, the server displays a figure in GIF showing a plot of the score for each serine or threonine residue against the sequence position of that residue.


EXAMPLE OUTPUT

The example below shows the output for the UniProt entry P17536 (TPM1_YEAST), tropomyosin 1.
>TPM1_YEAST	199 amino acids
#
# netphosyeast-1.0a prediction results
#
# Sequence		   # x   Context     Score   Kinase    Answer
# -------------------------------------------------------------------
# TPM1_YEAST               9 S   REKLSNLKL   0.390   main        . 
# TPM1_YEAST              17 S   LEAESWQEK   0.692   main       YES
# TPM1_YEAST              45 S   NQIKSLTVK   0.460   main        . 
# TPM1_YEAST              47 T   IKSLTVKNQ   0.508   main       YES
# TPM1_YEAST              65 S   EAGLSDSKQ   0.829   main       YES
# TPM1_YEAST              67 S   GLSDSKQTE   0.502   main       YES
# TPM1_YEAST              70 T   DSKQTEQDN   0.383   main        . 
# TPM1_YEAST              83 S   NQIKSLTVK   0.416   main        . 
# TPM1_YEAST              85 T   IKSLTVKNH   0.338   main        . 
# TPM1_YEAST             105 S   ELAESKQLS   0.434   main        . 
# TPM1_YEAST             109 S   SKQLSEDSH   0.750   main       YES
# TPM1_YEAST             112 S   LSEDSHHLQ   0.578   main       YES
# TPM1_YEAST             117 S   HHLQSNNDN   0.152   main        . 
# TPM1_YEAST             123 S   NDNFSKKNQ   0.406   main        . 
# TPM1_YEAST             136 S   DLEESDTKL   0.620   main       YES
# TPM1_YEAST             138 T   EESDTKLKE   0.308   main        . 
# TPM1_YEAST             143 T   KLKETTEKL   0.269   main        . 
# TPM1_YEAST             144 T   LKETTEKLR   0.213   main        . 
# TPM1_YEAST             150 S   KLRESDLKA   0.685   main       YES
# TPM1_YEAST             179 T   NEELTVKYE   0.172   main        . 
# TPM1_YEAST             195 S   EIAASLENL   0.803   main       YES
#
    MDKIREKLSNLKLEAESWQEKYEELKEKNKDLEQENVEKENQIKSLTVKN   #     50
    QQLEDEIEKLEAGLSDSKQTEQDNVEKENQIKSLTVKNHQLEEEIEKLEA   #    100
    ELAESKQLSEDSHHLQSNNDNFSKKNQQLEEDLEESDTKLKETTEKLRES   #    150
    DLKADQLERRVAALEEQREEWERKNEELTVKYEDAKKELDEIAASLENL    #    200
%1  ................S.............................T...   #     50
%1  ..............S.S.................................   #    100
%1  ........S..S.......................S.............S   #    150
%1  ............................................S....