Example of two sequences in Fasta Format

>seq1
AsTPGHtIIYEAVCLHNDRtTIP
>sp|Q16655|MAR1_HUMAN Melanoma antigen recognized by T-cells 1 OS=Homo sapiens OX=9606 GN=MLANA PE=1 SV=1
MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDK
SLHVGTQCALTRRCPQEGFDHRDSKVsLQEKNCEPVVPNAPPAyEKLsAEQSPPPysP

Please note that empty lines are not accepted, all sequences must have a name and no 
intervening characters are allowed between the initial ">" and the sequence name on 
the header line.

Detailed description of the FASTA format is available at NCBI.