//
The first part is an output in HOW format which contains on the first line the number of residues and the sequence name. Then follows the amino acid sequence and below is a representation of each amino acid with the corresponding prediction ('C' for cleavage site and '.' for nothing).
The second part is a listing of the examined residues (glutamines), their score, and in case the score exceeds the 0.5 threshold the amino acids around the cleavage site.
The third part is a graphical representation of the table in the second part of the output.
Multiple sequences are separated with '//'.
703 AT6B_HUMAN MAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLP 80 IFPDLQVKSEPSSPCSSSSLSSESSRLSTEPSSEALGVGEVLHVKTESLAPPLCLLGDDPTSSFETVQINVIPTSDDSSD 160 VQTKIEPVSPCSSVNSEASLLSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSLDGSSGKALPTR 240 KPPLQPKPVVLTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLPRPERKSIVPAPMPGNSCPPE 320 VDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCI 400 MVFLLFIAFNFGPVSISEPPSAPISPRMNKGEPQPRRHLLGFSEQEPVQGVEPLQGSSQGPKEPQPSPTDQPSFSNLTAF 480 PGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQPRKKSPPVKAVPIQPPGPP 560 ERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYE 640 EMMQIECEVMDTRVIHIKTSTVPPSLRKQPSPTPGNATGGPLPVSAASQAHQASHQPLYLNHP ................................................................................ 80 ................................................................................ 160 ................................................................................ 240 ................................................................................ 320 .....................................C.......................................... 400 ................................................................................ 480 ................................................................................ 560 ................................................................................ 640 ............................................................... Pos Score Cleavage ___________________________ 30 0.251 none 45 0.067 none 47 0.063 none 54 0.067 none 86 0.235 none 148 0.069 none 162 0.153 none 188 0.169 none 222 0.063 none 245 0.462 none 270 0.393 none 274 0.075 none 285 0.108 none 291 0.102 none 329 0.065 none 330 0.066 none 341 0.281 none 351 0.333 none 358 0.916 EARLQ^AVLAD 365 0.067 none 366 0.062 none 434 0.066 none 445 0.061 none 449 0.100 none 455 0.196 none 459 0.064 none 465 0.064 none 471 0.125 none 494 0.068 none 521 0.073 none 524 0.080 none 532 0.071 none 535 0.071 none 538 0.063 none 541 0.082 none 555 0.073 none 567 0.083 none 569 0.085 none 578 0.071 none 644 0.076 none 669 0.072 none 689 0.150 none 692 0.097 none 696 0.079 none ___________________________