Output format

Description

The long format output (default) consists of 5 columns:

Residue number.
Amino Acid
Asigned Prediction ('S' for prediction > threshold, '.' otherwise)
NOTE: the predicted cleavage site is after the assigned 'S' i.e. the peptide-bond on the C-terminal side of an amino acid with an assigned 'S' is cleaved.
Predcition score
Sequence name

When short output is chosen each input sequence will be shown with the predicted cleavage site indicated, with symbol S.

For each sequence the prediction ends with a line stating how many cleavage sites were identified.

EXAMPLE OUTPUT

Example output (long format) -------------------------------------- pos AA C score Ident -------------------------------------- ... 74 E . 0.107631 143B_BOVIN 75 K . 0.117492 143B_BOVIN 76 K . 0.083109 143B_BOVIN 77 Q . 0.557462 143B_BOVIN 78 Q S 0.850332 143B_BOVIN 79 M . 0.123313 143B_BOVIN 80 G . 0.344005 143B_BOVIN ... -------------------------------------- Number of cleavage sites 74. Number of amino acids 245. Protein name 143B_BOVIN -------------------------------------- Example output (short format) 245 143B_BOVIN TMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQ .S.S...S.SS.S......S.....SSS.....