Instructions



In order to use the DictyOglyc server for prediction on amino-acids sequences either: 

  1. Type the name of the sequence in the 'Sequence name' field 
  2. Click on the "Generate Graph" checkbox if you'd like to see a graph with the output (Gif/Postscript). These may be quite useful in seeing the "hot" spots in your protein. 
  3. Press the "Submit sequence" button. 
  4. A WWW page will return the results when the prediction is ready. Response time depends on system load. 
  5. OR

  6. Use the file browser to find your sequences in FASTA format in your own appropiate directory (a single file may contain multiple sequences).

  7. Example of two sequences in fasta format:

    >seq1
    ASTPGHTIIYEAVCLHNDRTTIP
    >seq2
    ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPK
    NMYKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGR
    KSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR

  8. Click on Generate graph if required, and then press the "Send file" button.