Output format



DESCRIPTION

An example of the output is found below. The output is divided into the following sections:



EXAMPLE OUTPUT




Query sequence:



>T0155

MADRIELRGLTVHGRHGVYDHERVAGQRFVIDVTVWIDLAEAANSDDLADTYDYVRLASR

AAEIVAGPPRKLIETVGAEIADHVMDDQRVHAVEVAVHKPQAPIPQTFDDVAVVIRRSRR

GGRGWVVPAGGAV



Searching for template ...



Round   0. All hits:

entry: 1DHN chain: _ score: 67 E: 5e-12

entry: 2DHN chain: _ score: 67 E: 5e-12

entry: 1B9L chain: A score: 28 E: 3.0

entry: 1B9L chain: B score: 28 E: 3.0

entry: 1B9L chain: C score: 28 E: 3.0

entry: 1B9L chain: D score: 28 E: 3.0

entry: 1B9L chain: E score: 28 E: 3.0

entry: 1B9L chain: F score: 28 E: 3.0

entry: 1B9L chain: G score: 28 E: 3.0

entry: 1B9L chain: H score: 28 E: 3.0



Round   0. Hits better than threshold: 0.050000:

entry: 1DHN chain: _ score: 67 E: 5e-12

entry: 2DHN chain: _ score: 67 E: 5e-12



Retrieving template ...



Entry: 1dhn

Chain: _



Making profile-profile alignment ...



Score:      31.0 bits

Identity:   42.6 %



Query: 1   MADRIELRGLTVHGRHGVYDHERVAGQRFVIDVTVWIDLAEAANSDDLADTYDY 54  

           M D I L+G+  +G HG    E   GQ F +DVT  +DL EA   D   DT  Y

Templ: 1   MQDTIFLKGMRFYGYHGALSAENEIGQIFKVDVTLKVDLSEAGRTDNVIDTVHY 54  



Modeling ...





File with coordinates for model in pdb format:model.pdb











PDB3D is a high speed 3D molecule rendering applet written by Scott Legrand at UCLA.

Controls:

  1. Left Mouse Button: Rotate molecule
  2. Right Mouse Button: Scale molecule (left & right)