The NetPhosBac 1.0 server predicts serine and threonine phosphorylation sites
in bacterial proteins. This service is closely related to
NetPhos,NetPhosK and NetPhosYeast.
Sequence submission: paste the sequence(s) and/or upload a local file
Restrictions:
At most 2,000 sequences and 200,000 amino acids per submission;
each sequence not longer than 6,000 amino acids.
Confidentiality:
The sequences are kept confidential and will be deleted
after processing.
For publication of results, please cite:
NetPhosBac - A predictor for Ser/Thr phosphorylation sites in bacterial proteins.
Martin Lee Miller, Boumediene Soufi, Carsten Jers, Nikolaj Blom, Boris Macek
and Ivan Majakovic.
Proteomics. 2008 Dec 3. PUBMED
All the other symbols will be converted to X before processing. The sequences can be input in the following two ways:
Both ways can be employed at the same time: all the specified sequences will be processed. However, there may be not more than 2,000 sequences and 200,000 amino acids in total in one submission. The sequences longer than 6,000 amino acids are not allowed.
If the button labelled 'Output in GFF' is checked the text output of the server will be in GFF
At any time during the wait you may enter your e-mail address and simply leave the window. Your job will continue; you will be notified by e-mail when it has terminated. The e-mail message will contain the URL under which the results are stored; they will remain on the server for 24 hours for you to collect them.
After the table, the whole sequence is printed alongside a summary of the predicted glycation sites and their positions.
Finally, if the 'Generate graphics' button has been checked, the server displays a figure in GIF showing a plot of the score for each serine or threonine residue against the sequence position of that residue. -->
>sp_P0A6C7_ARGA_ECO57 443 amino acids # # netphosbac-1.0a prediction results # # Sequence # x Context Score Kinase Answer # ------------------------------------------------------------------- # sp_P0A6C7_ARGA_ECO57 7 T KERKTELVE 0.319 main . # sp_P0A6C7_ARGA_ECO57 16 S GFRHSVPYI 0.591 main Y # sp_P0A6C7_ARGA_ECO57 22 T PYINTHRGK 0.482 main . # sp_P0A6C7_ARGA_ECO57 27 T HRGKTFVIM 0.474 main . # sp_P0A6C7_ARGA_ECO57 43 S HENFSSIVN 0.461 main . # sp_P0A6C7_ARGA_ECO57 44 S ENFSSIVND 0.498 main . # sp_P0A6C7_ARGA_ECO57 54 S GLLHSLGIR 0.673 main Y # sp_P0A6C7_ARGA_ECO57 89 T NIRVTDAKT 0.199 main . # sp_P0A6C7_ARGA_ECO57 93 T TDAKTLELV 0.420 main . # sp_P0A6C7_ARGA_ECO57 103 T QAAGTLQLD 0.171 main . # sp_P0A6C7_ARGA_ECO57 109 T QLDITARLS 0.452 main . # sp_P0A6C7_ARGA_ECO57 113 S TARLSMSLN 0.271 main . # sp_P0A6C7_ARGA_ECO57 115 S RLSMSLNNT 0.306 main . # sp_P0A6C7_ARGA_ECO57 119 T SLNNTPLQG 0.160 main . # sp_P0A6C7_ARGA_ECO57 130 S INVVSGNFI 0.439 main . # sp_P0A6C7_ARGA_ECO57 150 S DYCHSGRIR 0.839 main Y # sp_P0A6C7_ARGA_ECO57 167 S RQLDSGAIV 0.488 main . # sp_P0A6C7_ARGA_ECO57 179 S PVAVSVTGE 0.305 main . # sp_P0A6C7_ARGA_ECO57 181 T AVSVTGESF 0.285 main . # sp_P0A6C7_ARGA_ECO57 184 S VTGESFNLT 0.499 main . # sp_P0A6C7_ARGA_ECO57 188 T SFNLTSEEI 0.202 main . # sp_P0A6C7_ARGA_ECO57 189 S FNLTSEEIA 0.418 main . # sp_P0A6C7_ARGA_ECO57 194 T EEIATQLAI 0.228 main . # sp_P0A6C7_ARGA_ECO57 210 S IGFCSSQGV 0.476 main . # sp_P0A6C7_ARGA_ECO57 211 S GFCSSQGVT 0.413 main . # sp_P0A6C7_ARGA_ECO57 215 T SQGVTNDDG 0.184 main . # sp_P0A6C7_ARGA_ECO57 223 S GDIVSELFP 0.342 main . # sp_P0A6C7_ARGA_ECO57 245 S GDYNSGTVR 0.533 main Y # sp_P0A6C7_ARGA_ECO57 247 T YNSGTVRFL 0.359 main . # sp_P0A6C7_ARGA_ECO57 260 S KACRSGVRR 0.776 main Y # sp_P0A6C7_ARGA_ECO57 269 S CHLISYQED 0.312 main . # sp_P0A6C7_ARGA_ECO57 282 S QELFSRDGI 0.319 main . # sp_P0A6C7_ARGA_ECO57 288 T DGIGTQIVM 0.264 main . # sp_P0A6C7_ARGA_ECO57 294 S IVMESAEQI 0.516 main Y # sp_P0A6C7_ARGA_ECO57 302 T IRRATINDI 0.318 main . # sp_P0A6C7_ARGA_ECO57 326 S LVRRSREQL 0.456 main . # sp_P0A6C7_ARGA_ECO57 338 T IDKFTIIQR 0.451 main . # sp_P0A6C7_ARGA_ECO57 345 T QRDNTTIAC 0.442 main . # sp_P0A6C7_ARGA_ECO57 346 T RDNTTIACA 0.309 main . # sp_P0A6C7_ARGA_ECO57 374 S PDYRSSSRG 0.287 main . # sp_P0A6C7_ARGA_ECO57 375 S DYRSSSRGE 0.771 main Y # sp_P0A6C7_ARGA_ECO57 376 S YRSSSRGEV 0.701 main Y # sp_P0A6C7_ARGA_ECO57 392 S QAKQSGLSK 0.288 main . # sp_P0A6C7_ARGA_ECO57 395 S QSGLSKLFV 0.581 main Y # sp_P0A6C7_ARGA_ECO57 401 T LFVLTTRSI 0.432 main . # sp_P0A6C7_ARGA_ECO57 402 T FVLTTRSIH 0.362 main . # sp_P0A6C7_ARGA_ECO57 404 S LTTRSIHWF 0.729 main Y # sp_P0A6C7_ARGA_ECO57 414 T ERGFTPVDI 0.359 main . # sp_P0A6C7_ARGA_ECO57 424 S LLPESKKQL 0.294 main . # sp_P0A6C7_ARGA_ECO57 435 S YQRKSKVLM 0.548 main Y # MVKERKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHENFSSIVNDIG # 50 LLHSLGIRLVVVYGARPQIDANLAAHHHEPLYHKNIRVTDAKTLELVKQA # 100 AGTLQLDITARLSMSLNNTPLQGAHINVVSGNFIIAQPLGVDDGVDYCHS # 150 GRIRRIDEDAIHRQLDSGAIVLMGPVAVSVTGESFNLTSEEIATQLAIKL # 200 KAEKMIGFCSSQGVTNDDGDIVSELFPNEAQARVEAQEEKGDYNSGTVRF # 250 LRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRR # 300 ATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACA # 350 ALYPFPEEKIGEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVL # 400 TTRSIHWFQERGFTPVDIDLLPESKKQLYNYQRKSKVLMADLG # 450 %1 ...............S.................................. # 50 %1 ...S.............................................. # 100 %1 .................................................S # 150 %1 .................................................. # 200 %1 ............................................S..... # 250 %1 .........S.................................S...... # 300 %1 .................................................. # 350 %1 ........................SS..................S..... # 400 %1 ...S..............................S........ .
1Center for Biological Sequence Analysis,
Department of Systems Biology,
Technical University of Denmark, DK-2800 Lyngby, Denmark
4These authors contributed equally to this work.
2Center for Microbial Biotechnology,
Department of Systems Biology,
Technical University of Denmark, DK-2800 Lyngby, Denmark
3Department of Proteomics and Signal Transduction,
Max-Planck-Institute for Biochemistry, DE-82152 Martinsried, Germany
If you need help regarding technical issues (e.g. errors or missing results) contact Technical Support. Please include the name of the service and version (e.g. NetPhos-4.0). If the error occurs after the job has started running, please include the JOB ID (the long code that you see while the job is running).
If you have scientific questions (e.g. how the method works or how to interpret results), contact Correspondence.
Correspondence:
Technical Support: