DTU Health Tech
Department of Health Technology
This link is for the general contact of the DTU Health Tech institute.
If you need help with the bioinformatics programs, see the "Getting Help" section below the program.
The NetGlycate 1.0 server predicts glycation of ε amino groups of lysines in mammalian proteins.
For a description of the data set used to develop the NetGlycate method see here.
Note: This service has a high failure rate, due to a dependency on an old program. If your run fails, submit your sequences again. This does not affect the results.
Restrictions:
At most 2,000 sequences and 200,000 amino acids per submission;
each sequence not more than 4,000 and no less than 34 amino acids.
Confidentiality:
The sequences are kept confidential and will be deleted
after processing.
CITATIONS:
For publication of results, please cite:
Analysis and prediction of mammalian protein glycation.
Morten Bo Johansen, Lars Kiemer and Søren Brunak
Glycobiology, 16:844-853, 2006.
PMID: 16762979 doi: 10.1093/glycob/cwl009
All the other symbols will be converted to X before processing. The sequences can be input in the following two ways:
Both ways can be employed at the same time: all the specified sequences will
be processed. However, there may be not more than 2,000 sequences and
200,000 amino acids
in total in one submission. The sequences
longer than 4,000 amino acids will be ignored.
At any time during the wait you may enter your e-mail address and simply leave the window. Your job will continue; you will be notified by e-mail when it has terminated. The e-mail message will contain the URL under which the results are stored; they will remain on the server for 24 hours for you to collect them.
After the table, the whole sequence is printed alongside a summary of the predicted glycation sites and their positions.
Finally, if the 'Generate graphics' button has been checked, the server displays a figure in GIF showhing a plot of the score for each lysine residue against the sequence position of that residue.
>PPBI_BOVIN 533 amino acids # # netglycate-1.0 prediction results # # Sequence # Score Answer # ----------------------------------------------------------- # PPBI_BOVIN 43 -0.917 glycate . # PPBI_BOVIN 44 -0.883 glycate . # PPBI_BOVIN 53 -0.653 glycate . # PPBI_BOVIN 75 0.567 glycate YES # PPBI_BOVIN 81 -0.808 glycate . # PPBI_BOVIN 100 0.817 glycate YES # PPBI_BOVIN 123 -0.587 glycate . # PPBI_BOVIN 141 0.803 glycate YES # PPBI_BOVIN 156 -0.711 glycate . # PPBI_BOVIN 157 -0.864 glycate . # PPBI_BOVIN 160 -0.885 glycate . # PPBI_BOVIN 224 -0.837 glycate . # PPBI_BOVIN 247 0.491 glycate YES # PPBI_BOVIN 249 -0.704 glycate . # PPBI_BOVIN 259 -0.879 glycate . # PPBI_BOVIN 294 -0.825 glycate . # PPBI_BOVIN 303 0.972 glycate YES # PPBI_BOVIN 342 -0.845 glycate . # PPBI_BOVIN 359 -0.950 glycate . # PPBI_BOVIN 400 0.721 glycate YES # PPBI_BOVIN 405 -0.521 glycate . # MQGACVLLLLGLHLQLSLGLVPVEEEDPAFWNRQAAQALDVAKKLQPIQT # 50 AAKNVILFLGDGMGVPTVTATRILKGQMNGKLGPETPLAMDQFPYVALSK # 100 TYNVDRQVPDSAGTATAYLCGVKGNYRTIGVSAAARYNQCKTTRGNEVTS # 150 VMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADLPADAQMN # 200 GCQDIAAQLVNNMDIDVILGGGRKYMFPVGTPDPEYPDDASVNGVRKRKQ # 250 NLVQAWQAKHQGAQYVWNRTALLQAADDSSVTHLMGLFEPADMKYNVQQD # 300 HTKDPTLQEMTEVALRVVSRNPRGFYLFVEGGRIDHGHHDDKAYMALTEA # 350 GMFDNAIAKANELTSELDTLILVTADHSHVFSFGGYTLRGTSIFGLAPSK # 400 ALDSKSYTSILYGNGPGYALGGGSRPDVNDSTSEDPSYQQQAAVPQASET # 450 HGGEDVAVFARGPQAHLVHGVEEETFVAHIMAFAGCVEPYTDCNLPAPTT # 500 ATSIPDAAHLAASPPPLALLAGAMLLLLAPTLY # 550 %1 .................................................. # 50 %1 ........................G........................G # 100 %1 ........................................G......... # 150 %1 .................................................. # 200 %1 ..............................................G... # 250 %1 .................................................. # 300 %1 ..G............................................... # 350 %1 .................................................G # 400 %1 .................................................. # 450 %1 .................................................. # 500 %1 .................................![]()
Analysis and prediction of mammalian protein glycation.
Morten Bo Johansen, Lars Kiemer and Søren Brunak
Glycobiology, 16:844-853, 2006
PMID: 16762979 doi: 10.1093/glycob/cwl009
Center for Biological Sequence Analysis, BioCentrum-DTU,
The Technical University of Denmark, DK-2800 Lyngby, Denmark
If you need help regarding technical issues (e.g. errors or missing results) contact Technical Support. Please include the name of the service and version (e.g. NetPhos-4.0) and the options you have selected. If the error occurs after the job has started running, please include the JOB ID (the long code that you see while the job is running).
If you have scientific questions (e.g. how the method works or how to interpret results), contact Correspondence.
Correspondence:
Technical Support: